*Hidden Dangers of mRNA COVID-19 Vaccines - "VAIDS" and Much More

Go to content

*Hidden Dangers of mRNA COVID-19 Vaccines - "VAIDS" and Much More

Campbell M Gold.com
Published by Campbell M Gold in Allopathic · Sunday 15 Dec 2024 ·  11:00
Tags: mRNAvaccinesCOVID19VAIDSvaccinesafetyimmunesystemsideeffectspandemicvaccinationcontroversypublichealthvaccineconcerns
Hidden Dangers of mRNA COVID-19 Vaccines - "VAIDS" and Much More

This material, filled with sensitive and controversial content, is presented here not to influence your opinions but to ignite your academic curiosity. The information and interpretations herein do not reflect any opinion of this editor or our clients. Instead, they invite you to delve into a contentious but crucial re-evaluation.

Return to Blog Index

If you are happy with the Government's Information on this Subject
DO NOT READ FURTHER
Click on the Sign to Return to the Blog Index

Thought Police Alert
This Article can cause undesirable Thinking and Questioning - Get out now while you're still Blissfully Ignorant...

The party told you to reject the evidence of your eyes and ears.
It was their final, most essential command.
(George Orwell - 1984)

Sush - Info not allowed
Look what's just blown in... You're not supposed to know about this...

Unmasking the Hidden Dangers: How mRNA COVID-19 Vaccines Can Compromise Your Immune System & Essentially Cause "VAIDS"
(Vaccine-Acquired Immunodeficiency Syndrome)

Introduction

As we have seen from the so-called "COVID-19 Pandemic," almost everyone who promoted vaccines and vaccination mandates received financial gain from them. The supporters of vaccination, especially Big Pharma and controlling and suppressive governments typified by America and the UK, had serious personal interests—money and power—in promoting vaccines and vaccination.

Conversely, almost everyone who questioned or refused vaccination did so at a significant personal cost - they were overtly vilified, threatened, and accused of carrying and spreading disease and thus endangering the lives of those around them, especially the "vulnerable".

Vaccines are big business, and those who produce and promote them make colossal amounts of money. They do everything possible to protect an intellectually vulnerable but enormously lucrative business.

There is a large and increasing following in medical, political, and media circles that firmly believe that particular vaccines (i.e. mRNA and MMR) and vaccination (i.e. COVID) are some of the most offensive and dangerous of all modern medical practices.

The public is beginning to awaken, and they find it appalling that potentially dangerous vaccines/vaccinations are allowed to grow seemingly unchecked and unquestioned, especially by the institutions we rely upon and pay to protect us - i.e. governments and health services.

Outside of government, big pharma, and self-serving medical professionals, I don't believe the general public knows just how much harm is being done by the establishment's unquestioned enthusiasm for a practice of such doubtful value and with such potential for disaster.

F. A. Hayek said: "The whole apparatus for spreading knowledge, the schools and the press, wireless and cinema, [and especially social networking] will be used exclusively to spread those views which, whether true or false, will strengthen the belief in the rightness of the decisions taken by the authority; and all information that might cause doubt or hesitation will be withheld."
 
Pandemic

The COVID-19 pandemic led to an unprecedented global effort to develop and distribute vaccines. One of the most controversial technologies in the race was mRNA vaccination, which Pfizer and Moderna claimed showed high efficacy in preventing severe COVID-19 infections.
 
However, grave concerns have been raised since their roll-out and were raised before their roll-out regarding the potential impact of mRNA vaccines on the immune system.
 
This article will discuss the mRNA vaccination process, its deadly side effects, and the damage it can cause to the general immune system.
 
mRNA Vaccination - The Basics
 
Messenger RNA (mRNA) vaccines are a new class of "vaccines" (gene therapy) that are supposed to invade our cells and teach them how to make a protein that triggers an immune response. This immune response, which produces antibodies, allegedly protects us from getting infected if the virus enters our bodies.
 
mRNA Vaccines are Different from Traditional Vaccines
 
1) Because they aren’t vaccines, they’re gene therapy, and they were never before authorised to be given to humans on a mass scale until the FDA, MHRA, EMA, etc., granted Emergency Use Authorisation (EUA) to the COVID-19 mRNA jabs.
 
2) They differ because they do not use a live or weakened virus to stimulate an immune response. Instead, they use a small piece of genetic material called "mRNA", which encodes the instructions for producing a specific viral protein.
 
The mRNA is encased in a protective lipid nano-particle that helps deliver the genetic material into our cells. Once inside the cell, the mRNA is translated into the viral protein and presented on the cell’s surface. This presentation of the viral protein prompts the immune system to recognise it as "foreign" and produce antibodies to neutralise it.
 
Now you can see why they are gene therapy injections.
 
Potential Side Effects of mRNA Vaccination
 
Like any vaccine, mRNA vaccines can cause serious side effects. Authorities claim these side effects are generally mild and temporary, such as pain at the injection site, fatigue, headache, muscle pain, and fever, but they’re not telling the truth.
 
In reality, more severe side effects, such as anaphylaxis, myocarditis/pericarditis, severe heart disease, kidney/adrenal failure, cancer, blindness, brain bleeds, and a whole range of other dangerous consequences, have been reported.
 
Potential Risks to the Immune System
 
1) Overstimulation of the Immune System
 
The vaccine's mRNA encodes for producing a specific viral protein, which can trigger an immune response. The immune system may sometimes become overstimulated, leading to inflammation or autoimmune reactions. However, this risk is generally considered low, as the body quickly degrades and eliminates the vaccine's mRNA.
 
Explanation
 
The immune system is designed to recognise and eliminate foreign substances, such as viruses and bacteria. When a pathogen enters the body, the immune system mounts a response to neutralise and remove it. In the case of mRNA vaccination, the immune system is exposed to a small piece of genetic material that encodes for a specific viral protein. This exposure can trigger an immune response, producing antibodies that recognise and neutralise the viral protein.
 
While this immune response is essential for protection against the virus, there is a concern that the vaccine could overstimulate the immune system, leading to inflammation or autoimmune reactions. Inflammation is a natural part of the immune response, but excessive inflammation can cause damage to healthy tissues and organs.
 
Similarly, autoimmune reactions occur when the immune system mistakenly targets the body’s cells and tissues, leading to chronic inflammation and tissue damage.
 
Authorities claim that the mRNA in the vaccine is quickly degraded and eliminated by the body, minimising the duration of exposure to the viral protein. However, this isn’t true in most cases.
 
Clinical trials had only reached phase 3 when health authorities worldwide granted EUA to the COVID-19 mRNA vaccines. Real-world data shows a significantly increased mortality rate among the vaccinated compared to the unvaccinated, as well as a much higher risk of infection compared to the unvaccinated, suggesting an increased risk of autoimmune diseases or chronic inflammation in people who have received mRNA vaccines.
 
The UK Health Security Agency (UKHSA) published a weekly Vaccine Surveillance Report. Each report contained four weeks’ worth of data on COVID-19 cases, hospitalisations, and deaths by vaccination status.
 
Here are the COVID-19 case rates per 100,000 by vaccination status for each age group over the age of 18 in England, plus the average case rate per 100,000 for all adults in England taken from the UKHSA Vaccine Surveillance Report – Week 5 – 2022 (https://www.gov.uk/government/publications/covid-19-vaccine-weekly-surveillance-reports):
 

 
We can work out the real-world vaccine effectiveness using Pfizer’s vaccine effectiveness formula (https://expose-news.com/2021/10/29/ukhsa-report-covid-vaccines-negative-effectiveness-minus-132-percent/).
 
Here’s how effective the Covid-19 vaccines were proving to be in each double-vaccinated age group:
 
mRNA Vaccine Dangers
 
The lowest COVID-19 vaccine effectiveness was seen in England's 40-49 age group throughout January 2022, recorded at minus-209.4%, with the 50-59 age group not far behind.
 
However, vaccine effectiveness isn’t a measure of a vaccine; it is a measure of a vaccine recipient’s immune system performance compared to the immune system performance of an unvaccinated person.
 
Therefore, the UKHSA data shows that the COVID-19 injections decimate the natural immune system.
 
Then we also have the increased mortality rates among the vaccinated provided by the UK Government department known as the Office for National Statistics, as you can see from the following chart:
 
 
mRNA Vaccine Dangers
 
The above mortality rates, in detail, can be read here (https://expose-news.com/2023/03/30/unvaccinated-had-lowest-mortality-rate-in-2022/).
 
2) Activation of Latent Viruses
 
There is a concern that mRNA vaccination could activate dormant viruses, such as herpes or HIV. Further research is needed to understand the potential risks and should have been carried out before giving the COVID-19 mRNA vaccine to children and pregnant women.
 
Explanation
 
Latent viruses remain dormant in the body for extended periods without causing symptoms. Examples include herpes simplex virus (HSV) and human immunodeficiency virus (HIV). These viruses can persist in the body by integrating their genetic material into the host’s DNA or by forming a protective shell called a virion.
 
A theoretical concern is that mRNA vaccination could activate latent viruses by stimulating the immune system. When the immune system is activated, it produces cytokines and chemokines, signalling molecules that help recruit immune cells to the site of infection. These immune cells can potentially recognise and target latent viruses, leading to their activation and replication.
 
Sadly, plenty of evidence exists to support this claim, and the UK Government has published it. Clinical trials and real-world data have shown that the vaccinated are much more likely to be infected with the alleged COVID-19 virus than the unvaccinated. This suggests that the "vaccines" have either destroyed the immune systems of recipients or reactivated latent HIV viruses and caused recipients to develop Vaccine-Acquired Immunodeficiency Syndrome (VAIDS).
 
Furthermore, the body does not quickly degrade or eliminate the FACT mRNA in the vaccine. Instead, it multiplies millions of times and passes the blood-brain barrier, which may explain why COVID-19 mRNA vaccines have the potential to activate latent viruses.
 
3) Alteration of the Immune Response
 
Some researchers have suggested that mRNA vaccines could alter the immune system’s ability to recognise and respond to other pathogens.
 
Explanation
 
The immune system is a complex network of cells, tissues, and organs that work together to recognise and eliminate pathogens. One of the key components of the immune system is the adaptive immune response, which involves the production of antibodies and the activation of immune cells called lymphocytes. The adaptive immune response is precise and can recognise and neutralise various pathogens, including viruses, bacteria, and parasites.
 
There is a concern that mRNA vaccination could alter the immune system’s ability to recognise and respond to other pathogens. This could reduce the immune system's effectiveness in fighting infections and increase the disease risk.
 
This may explain why the vaccinated have a much higher mortality rate per 100,000 population and age than the unvaccinated.
 
mRNA Vaccine Dangers
 https://expose-news.com/2023/10/31/is-deagels-2025-depopulation-nightmare-unfolding/
 
Conclusion
 
The potential risks of mRNA vaccination to the immune system are a matter of ongoing research, and the official data clearly show that the benefits of these "vaccines" in preventing severe COVID-19 infections do not outweigh the potential risks - especially those confirmed today, 2024.
 
How can it be when the real-world effectiveness of the vaccines is in negative territory?
 
mRNA Vaccine Dangers
 
As with any vaccine, weighing the risks and benefits and making an informed decision about vaccination is essential.
 
In summary, mRNA vaccination has failed to protect against the alleged COVID-19 disease, and its potentially severe impact on the immune system remains a topic of discussion that is getting louder and louder.
 
The fact that mRNA COVID-19 vaccines are still being administered is astounding when all of this is considered.
 
11/04/2024
 
There you have it... What is your take on it all?...
 
Source
The Exposé
Adapted from: https://expose-news.com/2024/04/11/how-mrna-vaccines-compromise-immune-system-essentially-cause-vaids/#:~:text=Like%20any%20vaccine%2C%20mRNA%20vaccines,dangerous%20consequences%20have%20been%20reported
UK ONS
 
 


There are no reviews yet.
0
0
0
0
0
Enter your rating:
Back to content